PDB entry 1jp3

View 1jp3 on RCSB PDB site
Description: Structure of E.coli undecaprenyl pyrophosphate synthase
Class: transferase
Keywords: Rossmann fold, hydrophobic tunnel, product chain length, flexible loop, TRANSFERASE
Deposited on 2001-07-31, released 2001-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60472
      • modified residue (24)
      • modified residue (85)
      • modified residue (175)
      • modified residue (182)
    Domains in SCOPe 2.08: d1jp3a_
  • Chain 'B':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60472
      • modified residue (24)
      • modified residue (85)
      • modified residue (175)
      • modified residue (182)
    Domains in SCOPe 2.08: d1jp3b_
  • Heterogens: EGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jp3A (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp3A (A:)
    lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsm
    elfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyg
    grwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfll
    wqiayaelyftdvlwpdfdeqdfegalnafanre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jp3B (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp3B (B:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssalme
    lfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanygg
    rwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllw
    qiayaelyftdvlwpdfdeqdfegalnafan