PDB entry 1jow

View 1jow on RCSB PDB site
Description: Crystal structure of a complex of human CDK6 and a viral cyclin
Class: cell cycle/transferase
Keywords: CDK-cyclin complex, cyclin fold, CELL CYCLE/TRANSFERASE COMPLEX
Deposited on 2001-07-31, released 2002-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.266
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin homolog
    Species: Saimiriine herpesvirus 2 [TaxId:10381]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jowa1, d1jowa2
  • Chain 'B':
    Compound: cell division protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jowb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jowA (A:)
    madspnrlnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmh
    llcesfeldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvsklt
    ylscdcftnlelinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaastt
    ickaliqpniallspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkd
    qvseafslydleil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jowA (A:)
    nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
    dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnle
    linqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaasttickaliqpnia
    llspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkdqvseafslydl
    eil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jowB (B:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlercke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jowB (B:)
    dqqyecvygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhletfehpnv
    vrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldfl
    hshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqssy
    atpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwpqafhsksaqpie
    kfvtdidelgkdlllkcltfnpakrisaysalshpyf