PDB entry 1jor

View 1jor on RCSB PDB site
Description: Ensemble structures for unligated Staphylococcal nuclease-H124L
Class: hydrolase
Keywords: beta barrel, alpha helix, HYDROLASE
Deposited on 2001-07-30, released 2001-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: staphylococcal nuclease
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00644 (0-148)
    • engineered (123)
  Domains in SCOPe 2.08: d1jora_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jorA (A:)
  atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
  ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
  heqllrkseaqakkeklniwsednadsgq