PDB entry 1joo

View 1joo on RCSB PDB site
Description: averaged structure for unligated staphylococcal nuclease-h124l
Deposited on 2001-07-30, released 2001-08-22
The last revision prior to the SCOP 1.69 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jooa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jooA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqllrkseaqakkeklniwsednadsgq