PDB entry 1jom

View 1jom on RCSB PDB site
Description: the crystal structure of the binary complex between folinic acid (leucovorin) and e. coli dihydrofolate reductase
Deposited on 1996-02-25, released 1996-11-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.142
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1jom__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jom_ (-)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr