PDB entry 1jom

View 1jom on RCSB PDB site
Description: the crystal structure of the binary complex between folinic acid (leucovorin) and e. coli dihydrofolate reductase
Class: oxidoreductase
Keywords: methotrexate resistance, one-carbon metabolism oxidoreductase
Deposited on 1996-02-25, released 1996-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.142
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-158)
    • conflict (36)
  Domains in SCOPe 2.08: d1joma_
• Heterogens: CL, CA, FFO, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jomA (A:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr