PDB entry 1jok

View 1jok on RCSB PDB site
Description: Averaged structure for Staphylococcal nuclease-H124L in ternary complex with Ca2+ and thymidine-3',5'-bisphosphate
Class: hydrolase
Keywords: ternary complex, beta barrel, alpha helix
Deposited on 2001-07-30, released 2001-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: staphylococcal nuclease
  Species: Staphylococcus aureus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00644 (0-148)
    • engineered (123)
  Domains in SCOP 1.73: d1joka_
• Heterogens: THP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jokA (A:)
  atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
  ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
  heqllrkseaqakkeklniwsednadsgq