PDB entry 1joi

View 1joi on RCSB PDB site
Description: structure of pseudomonas fluorescens holo azurin
Deposited on 1997-06-09, released 1997-12-10
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-10, with a file datestamp of 1997-12-10.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1joi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1joi_ (-)
aeckvtvdstdqmsfntkaieidkscktftvelthsgslpknvmghnwvlssaadmpgia
sdgmaagidknylkegdtrviahtkiigagekdsvtfdvsklaagtdyaffcsfpghism
mkgtvtvk