PDB entry 1jog

View 1jog on RCSB PDB site
Description: Structure of HI0074 from Heamophilus Influenzae reveals the fold of a substrate binding domain of a nucleotidyltransferase
Deposited on 2001-07-29, released 2002-12-18
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1joga_
  • Chain 'B':
    Domains in SCOP 1.65: d1jogb_
  • Chain 'C':
    Domains in SCOP 1.65: d1jogc_
  • Chain 'D':
    Domains in SCOP 1.65: d1jogd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jogA (A:)
    mmtdklnlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkm
    mkrqlqqdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekama
    vyaqiddfliessflleqlrqrnqyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jogA (A:)
    nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq
    qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid
    dfliessflleqlrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jogB (B:)
    mmtdklnlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkm
    mkrqlqqdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekama
    vyaqiddfliessflleqlrqrnqyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jogB (B:)
    nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq
    qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid
    dfliessflleqlrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jogC (C:)
    mmtdklnlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkm
    mkrqlqqdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekama
    vyaqiddfliessflleqlrqrnqyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jogC (C:)
    nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq
    qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid
    dfliessflleqlrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jogD (D:)
    mmtdklnlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkm
    mkrqlqqdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekama
    vyaqiddfliessflleqlrqrnqyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jogD (D:)
    nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq
    qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid
    dfliessflleqlrqr