PDB entry 1joe

View 1joe on RCSB PDB site
Description: Crystal Structure of Autoinducer-2 Production Protein (LuxS) from Heamophilus influenzae
Class: signaling protein
Keywords: LuxS, HI0491, structural genomics, twinned crystal, Structure 2 Function Project, S2F, SIGNALING PROTEIN
Deposited on 2001-07-27, released 2001-08-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1joea_
  • Chain 'B':
    Compound: autoinducer-2 production protein
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1joeb_
  • Chain 'C':
    Compound: autoinducer-2 production protein
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1joec_
  • Chain 'D':
    Compound: autoinducer-2 production protein
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1joed_
  • Heterogens: HG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1joeA (A:)
    mplldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlf
    agfmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasi
    pelniyqcgsytehsledaheiaknviargigvnknedlsldnsllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1joeA (A:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1joeB (B:)
    mplldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlf
    agfmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasi
    pelniyqcgsytehsledaheiaknviargigvnknedlsldnsllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1joeB (B:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1joeC (C:)
    mplldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlf
    agfmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasi
    pelniyqcgsytehsledaheiaknviargigvnknedlsldnsllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1joeC (C:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1joeD (D:)
    mplldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlf
    agfmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasi
    pelniyqcgsytehsledaheiaknviargigvnknedlsldnsllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1joeD (D:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn