PDB entry 1joa

View 1joa on RCSB PDB site
Description: nadh peroxidase with cysteine-sulfenic acid
Deposited on 1996-07-02, released 1997-01-11
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1joa_ (-)
    mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
    mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
    pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
    ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
    avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
    narkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
    dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
    dfffqpafdkpwniintaaleavkqer