PDB entry 1jo8

View 1jo8 on RCSB PDB site
Description: Structural analysis of the yeast actin binding protein Abp1 SH3 domain
Class: structural protein
Keywords: SH3 domain Actin-binding-protein, STRUCTURAL PROTEIN
Deposited on 2001-07-27, released 2002-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.145
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin binding protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jo8a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jo8A (A:)
    pwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn