PDB entry 1jo6

View 1jo6 on RCSB PDB site
Description: Solution structure of the cytoplasmic N-terminus of the BK beta-subunit KCNMB2
Class: metal transport, membrane protein
Keywords: helix, ion channel, cytoplasmic part of, METAL TRANSPORT, MEMBRANE PROTEIN
Deposited on 2001-07-27, released 2001-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: potassium large conductance calcium-activated channel, subfamily M, beta member 2
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y691 (0-44)
  Domains in SCOPe 2.06: d1jo6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jo6A (A:)
  mfiwtsgrtsssyrhdekrniyqkirdhdlldkrktvtalkaged