PDB entry 1jnz

View 1jnz on RCSB PDB site
Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution
Class: oxidoreductase
Keywords: sulfur metabolism, adenylylsulfate reductase, iron-sulfur flavoprotein, crystal structure, catalysis, OXIDOREDUCTASE
Deposited on 2001-07-26, released 2002-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.161
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89579
      • conflict (182)
    Domains in SCOPe 2.04: d1jnza1, d1jnza2, d1jnza3
  • Chain 'B':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89580
    Domains in SCOPe 2.04: d1jnzb_
  • Chain 'C':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89579 (Start-642)
      • conflict (182)
    Domains in SCOPe 2.04: d1jnzc1, d1jnzc2, d1jnzc3
  • Chain 'D':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89580 (Start-149)
    Domains in SCOPe 2.04: d1jnzd_
  • Heterogens: SO3, FAD, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnzA (A:)
    mvyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaav
    ersgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtv
    hlfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifell
    kdnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdt
    gsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraael
    ekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafe
    dfldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyakl
    fplkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddav
    veelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktne
    kmlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyy
    yrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzA (A:)
    vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
    rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
    lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
    dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
    sgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaele
    kykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafed
    fldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyaklf
    plkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddavv
    eelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktnek
    mlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyy
    rtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnzB (B:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzB (B:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jnzC (C:)
    mvyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaav
    ersgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtv
    hlfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifell
    kdnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdt
    gsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraael
    ekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafe
    dfldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyakl
    fplkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddav
    veelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktne
    kmlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyy
    yrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzC (C:)
    vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
    rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
    lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
    dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
    sgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaele
    kykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafed
    fldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyaklf
    plkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddavv
    eelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktnek
    mlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyy
    rtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jnzD (D:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzD (D:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka