PDB entry 1jnz

View 1jnz on RCSB PDB site
Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution
Deposited on 2001-07-26, released 2002-03-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.161
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnzA (A:)
    mvyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaav
    ersgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtv
    hlfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifell
    kdnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdt
    gsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraael
    ekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafe
    dfldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyakl
    fplkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddav
    veelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktne
    kmlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyy
    yrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzA (A:)
    vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
    rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
    lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
    dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
    sgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaele
    kykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafed
    fldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyaklf
    plkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddavv
    eelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktnek
    mlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyy
    rtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnzB (B:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzB (B:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jnzC (C:)
    mvyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaav
    ersgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtv
    hlfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifell
    kdnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdt
    gsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraael
    ekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafe
    dfldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyakl
    fplkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddav
    veelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktne
    kmlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyy
    yrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzC (C:)
    vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
    rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
    lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
    dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
    sgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaele
    kykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafed
    fldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyaklf
    plkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddavv
    eelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktnek
    mlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyy
    rtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jnzD (D:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnzD (D:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka