PDB entry 1jny

View 1jny on RCSB PDB site
Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP
Class: translation
Keywords: gtpase, alpha/beta structure, protein biosynthesis, translation
Deposited on 2001-07-26, released 2002-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35021
      • conflict (14)
      • conflict (195)
      • conflict (202)
      • conflict (346)
    Domains in SCOPe 2.06: d1jnya1, d1jnya2, d1jnya3
  • Chain 'B':
    Compound: Elongation factor 1-alpha
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35021
      • conflict (14)
      • conflict (195)
      • conflict (202)
      • conflict (346)
    Domains in SCOPe 2.06: d1jnyb1, d1jnyb2, d1jnyb3
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnyA (A:)
    msqkphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflld
    rlkeerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkg
    eyeagmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsy
    gfntnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppkpvdkplripiqdv
    ysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvr
    gvekkdikrgdvvghpnnpptvadeftariivvwhptalangytpvlhvhtasvacrvse
    lvskldprtgqeaeknpqflkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvg
    vgiivdvkpakveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnyA (A:)
    kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
    eemrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtre
    hiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvva
    psgdnithksenmkwyngptleeyldqlelppkpvdkplripiqdvysisgvgtvpvgrv
    esgvlkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvrgvekkdikrgdvvg
    hpnnpptvadeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeae
    knpqflkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnyB (B:)
    msqkphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflld
    rlkeerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkg
    eyeagmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsy
    gfntnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppkpvdkplripiqdv
    ysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvr
    gvekkdikrgdvvghpnnpptvadeftariivvwhptalangytpvlhvhtasvacrvse
    lvskldprtgqeaeknpqflkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvg
    vgiivdvkpakveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnyB (B:)
    kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrmr
    fetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtrehiil
    aktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvvapsgd
    nithksenmkwyngptleeyldqlelppkpvdkplripiqdvysisgvgtvpvgrvesgv
    lkvgdkivfmpagkvgevrsiethhtkmdkaepgdnigfnvrgvekkdikrgdvvghpnn
    pptvadeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpq
    flkqgdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa