PDB entry 1jnt

View 1jnt on RCSB PDB site
Description: NMR Structure of the E. coli Peptidyl-Prolyl cis/trans-Isomerase Parvulin 10
Class: isomerase
Keywords: alpha-beta sandwich, cis peptide bond
Deposited on 2001-07-25, released 2003-06-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-05, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase c
    Species: Escherichia coli
    Gene: parA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jnta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jntA (A:)
    aktaaalhilvkeeklaldlleqikngadfgklakkhsicpsgkrggdlgefrqgqmvpa
    fdkvvfscpvleptgplhtqfgyhiikvlyrn