PDB entry 1jnr

View 1jnr on RCSB PDB site
Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution
Class: oxidoreductase
Keywords: sulfur metabolism/ adenylylsulfate reductase/ iron-sulfur flavoprotein/ crystal structure/catalysis, OXIDOREDUCTASE
Deposited on 2001-07-25, released 2002-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28603 (Start-642)
      • conflict (182)
    Domains in SCOPe 2.04: d1jnra1, d1jnra2, d1jnra3
  • Chain 'B':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jnrb_
  • Chain 'C':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28603 (Start-642)
      • conflict (182)
    Domains in SCOPe 2.04: d1jnrc1, d1jnrc2, d1jnrc3
  • Chain 'D':
    Compound: adenylylsulfate reductase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jnrd_
  • Heterogens: FAD, SF4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnrA (A:)
    mvyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaav
    ersgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtv
    hlfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifell
    kdnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdt
    gsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraael
    ekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafe
    dfldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyakl
    fplkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddav
    veelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktne
    kmlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyy
    yrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnrA (A:)
    vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
    rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
    lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
    dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
    sgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaele
    kykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafed
    fldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyaklf
    plkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddavv
    eelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktnek
    mlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyy
    rtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnrB (B:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnrB (B:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jnrC (C:)
    mvyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaav
    ersgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtv
    hlfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifell
    kdnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdt
    gsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraael
    ekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafe
    dfldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyakl
    fplkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddav
    veelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktne
    kmlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyy
    yrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnrC (C:)
    vyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaave
    rsgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtvh
    lfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifellk
    dnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdtg
    sgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaele
    kykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafed
    fldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyaklf
    plkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddavv
    eelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktnek
    mlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyy
    rtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jnrD (D:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnrD (D:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka