PDB entry 1jnq

View 1jnq on RCSB PDB site
Description: lipoxygenase-3 (soybean) complex with epigallocathechin (egc)
Class: oxidoreductase
Keywords: metalloprotein, fe(II) complex, purple lipoxygenase, catechin inhibitor, green tea, oxidoreductase
Deposited on 2001-07-24, released 2003-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-3
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jnqa1, d1jnqa2
  • Heterogens: FE2, EGT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnqA (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnqA (A:)
    ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
    dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
    sltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlr
    gdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpn
    sesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevh
    glysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefarem
    lagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflld
    hhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflp
    adegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllh
    phyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrg
    maiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacw
    kelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrpt
    lsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdn
    pnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltf
    rgipnsisi