PDB entry 1jnp

View 1jnp on RCSB PDB site
Description: Crystal Structure of Murine Tcl1 at 2.5 Resolution
Class: immune system
Keywords: beta barrel, dimer, immune system
Deposited on 2001-07-24, released 2001-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell leukemia/lymphoma protein 1a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56280
      • engineered (84)
    Domains in SCOPe 2.07: d1jnpa_
  • Chain 'B':
    Compound: T-cell leukemia/lymphoma protein 1a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56280
      • engineered (84)
    Domains in SCOPe 2.07: d1jnpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnpA (A:)
    matqrahraetpahpnrlwiwekhvyldefrrswlpvviksnekfqvilrqedvtlgeam
    spsqlvpyelplmwqlypkdryrsadsmywqilyhikfrdvedmllelidsesnde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnpA (A:)
    raetpahpnrlwiwekhvyldefrrswlpvviksnekfqvilrqedvtlgeamspsqlvp
    yelplmwqlypkdryrsadsmywqilyhikfrdvedmllel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnpB (B:)
    matqrahraetpahpnrlwiwekhvyldefrrswlpvviksnekfqvilrqedvtlgeam
    spsqlvpyelplmwqlypkdryrsadsmywqilyhikfrdvedmllelidsesnde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnpB (B:)
    raetpahpnrlwiwekhvyldefrrswlpvviksnekfqvilrqedvtlgeamspsqlvp
    yelplmwqlypkdryrsadsmywqilyhikfrdvedmllel