PDB entry 1jnn

View 1jnn on RCSB PDB site
Description: Crystal Structure of Fab-Estradiol Complexes
Deposited on 2001-07-24, released 2002-02-06
The last revision prior to the SCOP 1.69 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.211
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jnnH (H:)
    evqlqqsgaelvkpgasvrlscsasgfnikdtymfwvkqrpeqgldwigrinpangisky
    dprfqgkatltadtssntaylqldnltsedtavyycaiekdlpwgqgtlvtvsvakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jnnL (L:)
    qivmtqtpaslsasvgetvtitcrasgniynylawyqqkqgkspqllvynaktlvdgvpl
    rfsgsgsgtqyslkinslqpedfgnyychhfwntpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr