PDB entry 1jnl

View 1jnl on RCSB PDB site
Description:
Deposited on 2001-07-24, released 2002-02-06
The last revision prior to the SCOP 1.65 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jnlh1, d1jnlh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jnll1, d1jnll2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jnlH (H:)
    evqlqqsgaelvkpgasvrlscsasgfnikdtymfwvkqrpeqgldwigrinpangisky
    dprfqgkatltadtssntaylqldnltsedtavyycaiekdlpwgqgtlvtvsvakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jnlL (L:)
    qivmtqtpaslsasvgetvtitcrasgniynylawyqqkqgkspqllvynaktlvdgvpl
    rfsgsgsgtqyslkinslqpedfgnyychhfwntpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr