PDB entry 1jnh

View 1jnh on RCSB PDB site
Description: Crystal Structure of Fab-Estradiol Complexes
Class: immune system
Keywords: igg fold, antibody-hapten complex, estradiol
Deposited on 2001-07-24, released 2002-02-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01843 (0-107)
      • see remark 999 (210-211)
    • GB AAC52488 (Start-209)
    Domains in SCOP 1.75: d1jnha1, d1jnha2
  • Chain 'B':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin gamma-1 chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAK01087 (0-212)
    • GB AAC52820 (213-217)
    Domains in SCOP 1.75: d1jnhb1, d1jnhb2
  • Chain 'C':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01843 (0-107)
      • see remark 999 (210-211)
    • GB AAC52488 (Start-209)
    Domains in SCOP 1.75: d1jnhc1, d1jnhc2
  • Chain 'D':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin gamma-1 chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAK01087 (0-212)
    • GB AAC52820 (213-217)
    Domains in SCOP 1.75: d1jnhd1, d1jnhd2
  • Chain 'E':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01843 (0-107)
      • see remark 999 (210-211)
    • GB AAC52488 (Start-209)
    Domains in SCOP 1.75: d1jnhe1, d1jnhe2
  • Chain 'F':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin gamma-1 chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAK01087 (0-212)
    • GB AAC52820 (213-217)
    Domains in SCOP 1.75: d1jnhf1, d1jnhf2
  • Chain 'G':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01843 (0-107)
      • see remark 999 (210-211)
    • GB AAC52488 (Start-209)
    Domains in SCOP 1.75: d1jnhg1, d1jnhg2
  • Chain 'H':
    Compound: monoclonal anti-estradiol 10g6d6 immunoglobulin gamma-1 chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAK01087 (0-212)
    • GB AAC52820 (213-217)
    Domains in SCOP 1.75: d1jnhh1, d1jnhh2
  • Heterogens: ECO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jnhA (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhA (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jnhB (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhB (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jnhC (C:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhC (C:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jnhD (D:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhD (D:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jnhE (E:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhE (E:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jnhF (F:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhF (F:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jnhG (G:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhG (G:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtvekslsaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jnhH (H:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jnhH (H:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp