PDB entry 1jnd

View 1jnd on RCSB PDB site
Description: crystal structure of imaginal disc growth factor-2
Deposited on 2001-07-23, released 2002-05-01
The last revision prior to the SCOP 1.67 freeze date was dated 2002-05-01, with a file datestamp of 2002-05-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.176
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jndA (A:)
    asnlvcyydsssytreglgkllnpdleialqfcshlvygyaglrgenlqaysmnenldiy
    khqfsevtslkrkyphlkvllsvggdhdidpdhpnkyidllegekvrqigfirsayelvk
    tygfdgldlayqfpknkprkvhgdlglawksikklftgdfivdphaalhkeqftalvrdv
    kdslradgfllsltvlpnvnstwyfdipalnglvdfvnlatfdfltparnpeeadysapi
    yhpdgskdrlahlnadfqveywlsqgfpsnkinlgvatygnawkltkdsglegvpvvpet
    sgpapegfqsqkpgllsyaeicgklsnpqnqflkgnesplrrvsdptkrfggiayrpvdg
    qitegiwvsyddpdsasnkaayarvknlggvalfdlsyddfrgqcsgdkypilraikyrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jndA (A:)
    snlvcyydsssytreglgkllnpdleialqfcshlvygyaglrgenlqaysmnenldiyk
    hqfsevtslkrkyphlkvllsvggdhdidpdhpnkyidllegekvrqigfirsayelvkt
    ygfdgldlayqfpknkprkvivdphaalhkeqftalvrdvkdslradgfllsltvlpnvn
    stwyfdipalnglvdfvnlatfdfltparnpeeadysapiyhpdgskdrlahlnadfqve
    ywlsqgfpsnkinlgvatygnawkltkdsglegvpvvpetsgpapegfqsqkpgllsyae
    icgklsnpqnqflkgnesplrrvsdptkrfggiayrpvdgqitegiwvsyddpdsasnka
    ayarvknlggvalfdlsyddfrgqcsgdkypilraikyrl