PDB entry 1jnc

View 1jnc on RCSB PDB site
Description: beta-1,4-galactosyltransferase complex with alpha-lactalbumin and UDP-glucose
Class: transferase activator/transferase
Keywords: beta1,4-galactosyltransferase, alpha-lactalbumin, 1:1 protein complex, UDP-glucose, manganese ion binding
Deposited on 2001-07-23, released 2002-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-02-18, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.245
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29752
      • conflict (14)
      • conflict (26)
      • conflict (37)
      • conflict (56)
      • conflict (89)
      • conflict (95)
    Domains in SCOPe 2.07: d1jnca_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037
      • conflict (28)
      • conflict (57)
    Domains in SCOPe 2.07: d1jncb1, d1jncb2
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29752 (0-122)
      • conflict (14)
      • conflict (26)
      • conflict (37)
      • conflict (56)
      • conflict (89)
      • conflict (95)
    Domains in SCOPe 2.07: d1jncc_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-272)
      • conflict (28)
      • conflict (57)
    Domains in SCOPe 2.07: d1jncd_
  • Heterogens: CA, MN, GUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jncA (A:)
    teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
    ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jncB (B:)
    sltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfr
    nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
    fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
    nywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jncB (B:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jncC (C:)
    teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
    ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jncD (D:)
    sltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfr
    nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
    fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
    nywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jncD (D:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps