PDB entry 1jn9

View 1jn9 on RCSB PDB site
Description: Structure of Putative Asparaginase Encoded by Escherichia coli ybiK Gene
Deposited on 2001-07-23, released 2003-09-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1jn9.1
  • Chain 'B':
    Domains in SCOP 1.67: d1jn9.1
  • Chain 'C':
    Domains in SCOP 1.67: d1jn9.2
  • Chain 'D':
    Domains in SCOP 1.67: d1jn9.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jn9A (A:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaarkegatvldhsgapldekqkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn9A (A:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaarke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jn9B (B:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyrekgdtvatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn9B (B:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jn9C (C:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaarkegatvldhsgapldekqkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn9C (C:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaark
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jn9D (D:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyrekgdtvatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn9D (D:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyre