PDB entry 1jn2

View 1jn2 on RCSB PDB site
Description: Crystal Structure of meso-tetrasulphonatophenyl porphyrin complexed with Concanavalin A
Class: sugar binding protein
Keywords: lectin
Deposited on 2001-07-22, released 2003-07-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-08-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: concanavalin a
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • see remark 999 (117)
      • see remark 999 (150)
      • see remark 999 (154)
    Domains in SCOP 1.75: d1jn2p_
  • Heterogens: CA, MN, SFP, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jn2P (P:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan