PDB entry 1jn0

View 1jn0 on RCSB PDB site
Description: Crystal structure of the non-regulatory A4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with NADP
Class: oxidoreductase
Keywords: rossman fold, protein-nadp complex, nadph
Deposited on 2001-07-21, released 2001-11-30
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Spinacia oleracea
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jn0a1, d1jn0a2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Spinacia oleracea
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jn0b1, d1jn0b2
  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Spinacia oleracea
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jn0o1, d1jn0o2
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jn0A (A:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn0A (A:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jn0B (B:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn0B (B:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1jn0O (O:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn0O (O:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwq