PDB entry 1jn0

View 1jn0 on RCSB PDB site
Description: Crystal structure of the non-regulatory A4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with NADP
Deposited on 2001-07-21, released 2001-11-30
The last revision prior to the SCOP 1.65 freeze date was dated 2001-11-30, with a file datestamp of 2001-11-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jn0A (A:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn0A (A:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jn0B (B:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn0B (B:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1jn0O (O:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn0O (O:)
    klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
    agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
    apgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttthsy
    tgdqrlldashrdlrraraaclnivptstgaakavalvlpqlkgklngialrvptpnvsv
    vdlvvqvskktfaeevnaafresadqelkgilsvcdeplvsidfrctdvsstidssltmv
    mgddmvkviawydnewgysqrvvdladivankwq