PDB entry 1jmy

View 1jmy on RCSB PDB site
Description: Truncated Recombinant Human Bile Salt Stimulated Lipase
Class: hydrolase
Keywords: BSSL, BSDL, Bile salt dependent lipase, Bile salt stimulated lipase, HYDROLASE
Deposited on 2001-07-20, released 2001-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.236
AEROSPACI score: -1.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bile-salt-activated lipase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19835 (0-517)
      • conflict (330)
      • cloning artifact (518-521)
    Domains in SCOPe 2.07: d1jmya1, d1jmya2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmyA (A:)
    aklgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkaknf
    kkrclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganfl
    nnylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrniaa
    fggdpnnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakkv
    aekvgcpvgdaarmaqclkvtdpraltlaykvplagleypmlhyvgfvpvidgdfipadp
    inlyanaadidyiagtnnmdghifasidmprinkgnkkvteedfyklvseftitkglrga
    kttfdvyteswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfsh
    psrmpvypkwvgadhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmg
    dsavpthwepyttensgyleitkkmgsssmkrslrtnfpgih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmyA (A:)
    aklgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkaknf
    kkrclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganfl
    nnylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrniaa
    fggdpnnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakkv
    aekvgcpvgdaarmaqclkvtdpraltlaykvpmlhyvgfvpvidgdfipadpinlyana
    adidyiagtnnmdghifasidmprinkgnkkvteedfyklvseftitkglrgakttfdvy
    teswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfshpsrmpvy
    pkwvgadhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmgdsavpth
    wepyttensgyleitkkmgsssmkrslrtnfpgih