PDB entry 1jmv

View 1jmv on RCSB PDB site
Description: Structure of Haemophylus influenzae Universal Stress Protein At 1.85A Resolution
Deposited on 2001-07-20, released 2001-12-12
The last revision prior to the SCOP 1.65 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1jmva_
  • Chain 'B':
    Domains in SCOP 1.65: d1jmvb_
  • Chain 'C':
    Domains in SCOP 1.65: d1jmvc_
  • Chain 'D':
    Domains in SCOP 1.65: d1jmvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmvA (A:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
    istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
    strqvmntikidmlvvplrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmvA (A:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
    istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
    strqvmntikidmlvvplrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jmvB (B:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
    istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
    strqvmntikidmlvvplrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmvB (B:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmsqdris
    tetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklmsst
    rqvmntikidmlvvplr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jmvC (C:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
    istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
    strqvmntikidmlvvplrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmvC (C:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsytglidvnmssmqdtet
    qkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklmsstrqv
    mntikidmlvvpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jmvD (D:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
    istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
    strqvmntikidmlvvplrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmvD (D:)
    mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfslytglidvnmstqkall
    dlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklmsstrqvmntik
    idmlvvp