PDB entry 1jmt

View 1jmt on RCSB PDB site
Description: X-ray Structure of a Core U2AF65/U2AF35 Heterodimer
Class: RNA binding protein
Keywords: rrm, RNA splicing, proline, ppii helix, peptide recognition, RNA binding protein
Deposited on 2001-07-19, released 2001-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 35 kda subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01081 (0-103)
      • engineered (24)
    Domains in SCOPe 2.08: d1jmta_
  • Chain 'B':
    Compound: splicing factor u2af 65 kda subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmtA (A:)
    sqtiallniyrnpqnssqsadglrsavsdvemqehydeffeevftemeekygeveemnvc
    dnlgdhlvgnvyvkfrreedaekavidlnnrwfngqpihaelsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmtA (A:)
    sqtiallniyrnpqdglrsavsdvemqehydeffeevftemeekygeveemnvcdnlgdh
    lvgnvyvkfrreedaekavidlnnrwfngqpihaelsp
    

  • Chain 'B':
    No sequence available.