PDB entry 1jmq

View 1jmq on RCSB PDB site
Description: YAP65 (L30K mutant) WW domain in Complex with GTPPPPYTVG peptide
Class: structural protein
Keywords: WW domain, polyproline ligand, YAP65 mutant, STRUCTURAL PROTEIN
Deposited on 2001-07-19, released 2001-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 65 kda yes-associated protein
  Species: Homo sapiens [TaxId:9606]
  Gene: YAP65
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46937 (0-45)
    • engineered (25)
  Domains in SCOPe 2.07: d1jmqa_
• Chain 'P':
  Compound: WW Domain Binding Protein-1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • GB AAD10950 (0-9)
    • see remark 999 (9)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jmqA (A:)
  feipddvplpagwemaktssgqryfknhidqtttwqdprkamlsqm
  

  
  
• Chain 'P':
  No sequence available.