PDB entry 1jmn

View 1jmn on RCSB PDB site
Description: Solution Structure of the Viscotoxin A2
Class: toxin
Keywords: thionin, nmr, viscotoxin, Viscum album
Deposited on 2001-07-19, released 2003-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viscotoxin A2
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32880 (0-45)
      • see remark 999 (23)
      • see remark 999 (42-44)
    Domains in SCOPe 2.08: d1jmna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jmnA (A:)
    ksccpnttgrniyntcrfgggsrqvcaslsgckiisastcpsdypk