PDB entry 1jml

View 1jml on RCSB PDB site
Description:
Deposited on 2001-07-19, released 2001-10-10
The last revision prior to the SCOP 1.65 freeze date was dated 2001-10-10, with a file datestamp of 2001-10-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: -1.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jmla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jmlA (A:)
    mhhhhhhgmeevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvv
    pkaytlnikfag