PDB entry 1jme

View 1jme on RCSB PDB site
Description: Crystal Structure of Phe393His Cytochrome P450 BM3
Class: oxidoreductase
Keywords: cytochrome p450, fatty acid hydroxylase, monooxygenase, oxidoreductase
Deposited on 2001-07-18, released 2001-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: CYP102A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (Start-454)
      • engineered (392)
    Domains in SCOPe 2.08: d1jmea_
  • Chain 'B':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: CYP102A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (Start-454)
      • engineered (392)
    Domains in SCOPe 2.08: d1jmeb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmeA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkphgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmeA (A:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
    desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
    eamnklnkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeni
    ryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyv
    gmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveef
    rperfenpsaipqhafkphgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldik
    etltlkpegfvvkakskkipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jmeB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkphgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmeB (B:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
    desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
    eamnklnkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeni
    ryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyv
    gmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveef
    rperfenpsaipqhafkphgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldik
    etltlkpegfvvkakskkipl