PDB entry 1jmc

View 1jmc on RCSB PDB site
Description: single stranded dna-binding domain of human replication protein a bound to single stranded dna, rpa70 subunit, residues 183-420
Deposited on 1996-11-11, released 1997-10-15
The last revision prior to the SCOP 1.69 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jmcA (A:)
    gshmqskvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeirat
    afneqvdkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlp
    tvqfdftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvv
    tatlwgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfd
    aegqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jmcA (A:)
    kvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafneqv
    dkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlptvqfdf
    tgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvtatlwg
    edadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdaegq