PDB entry 1jlt

View 1jlt on RCSB PDB site
Description: Vipoxin Complex
Class: hydrolase
Keywords: heterodimer complex, phospholipase, hydrolase, vipoxin, pla2-activity
Deposited on 2001-07-16, released 2001-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2 inhibitor
    Species: Vipera ammodytes ammodytes [TaxId:8705]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04084 (0-121)
      • conflict (33)
    Domains in SCOPe 2.08: d1jlta_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Vipera ammodytes ammodytes [TaxId:8705]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jltb_
  • Heterogens: MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jltA (A:)
    nlfqfgdmilqktgkeavhsyaiygcycgwggqaraqdatdrccfaqdccygrvndcnpk
    tatytysfengdivcgdndlclravcecdraaaiclgenvntydknyeyysishcteese
    qc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jltB (B:)
    nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
    laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
    qc