PDB entry 1jls

View 1jls on RCSB PDB site
Description: structure of the uracil phosphoribosyltransferase uracil/cpr 2 mutant c128v
Class: transferase
Keywords: TRANSFERASE, GLYCOSYLTRANSFERASE, UPRTASE, ternary complex, UPRT-cprpp-uracil
Deposited on 2001-07-16, released 2002-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uracil phosphoribosytransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998
      • conflict (82)
      • engineered (126)
      • conflict (155)
    Domains in SCOPe 2.06: d1jlsa_
  • Chain 'B':
    Compound: Uracil phosphoribosytransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (Start-242)
      • conflict (82)
      • engineered (126)
      • conflict (155)
    Domains in SCOPe 2.06: d1jlsb_
  • Chain 'C':
    Compound: Uracil phosphoribosytransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998
      • conflict (82)
      • engineered (126)
      • conflict (155)
    Domains in SCOPe 2.06: d1jlsc_
  • Chain 'D':
    Compound: Uracil phosphoribosytransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998
      • conflict (82)
      • engineered (126)
      • conflict (155)
    Domains in SCOPe 2.06: d1jlsd_
  • Heterogens: PO4, MG, URA, PRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jlsA (A:)
    aqvpasgkllvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkee
    fvfyadrlirllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesgl
    ravcrgvrigkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievll
    rlgvkeeriifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryf
    gtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlsA (A:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdep
    kliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapqgier
    vfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jlsB (B:)
    aqvpasgkllvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkee
    fvfyadrlirllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesgl
    ravcrgvrigkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievll
    rlgvkeeriifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryf
    gtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlsB (B:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jlsC (C:)
    aqvpasgkllvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkee
    fvfyadrlirllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesgl
    ravcrgvrigkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievll
    rlgvkeeriifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryf
    gtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlsC (C:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jlsD (D:)
    aqvpasgkllvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkee
    fvfyadrlirllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesgl
    ravcrgvrigkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievll
    rlgvkeeriifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryf
    gtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlsD (D:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdep
    kliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapqgier
    vfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt