PDB entry 1jls

View 1jls on RCSB PDB site
Description: structure of the uracil phosphoribosyltransferase uracil/cpr 2 mutant c128v
Deposited on 2001-07-16, released 2002-01-16
The last revision prior to the SCOP 1.61 freeze date was dated 2002-01-16, with a file datestamp of 2002-01-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jlsa_
  • Chain 'B':
    Domains in SCOP 1.61: d1jlsb_
  • Chain 'C':
    Domains in SCOP 1.61: d1jlsc_
  • Chain 'D':
    Domains in SCOP 1.61: d1jlsd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jlsA (A:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlsA (A:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdep
    kliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapqgier
    vfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlsB (B:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlsC (C:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jlsD (D:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlsD (D:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdep
    kliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapqgier
    vfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt