PDB entry 1jlr

View 1jlr on RCSB PDB site
Description: structure of the uracil phosphoribosyltransferase gtp complex 2 mutant c128v
Deposited on 2001-07-16, released 2002-01-10
The last revision prior to the SCOP 1.61 freeze date was dated 2002-01-10, with a file datestamp of 2002-01-10.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.184
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jlra_
  • Chain 'B':
    Domains in SCOP 1.61: d1jlrb_
  • Chain 'C':
    Domains in SCOP 1.61: d1jlrc_
  • Chain 'D':
    Domains in SCOP 1.61: d1jlrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlrA (A:)
    llvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrl
    irllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvr
    igkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeer
    iifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlrB (B:)
    llvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrl
    irllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvr
    igkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeer
    iifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlrC (C:)
    llvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrl
    irllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvr
    igkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeer
    iifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlrD (D:)
    llvdprystndqeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrl
    irllieealnelpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvr
    igkiliqrdettaepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeer
    iifvnilaapqgiervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm