PDB entry 1jln

View 1jln on RCSB PDB site
Description: Crystal structure of the catalytic domain of protein tyrosine phosphatase PTP-SL/BR7
Deposited on 2001-07-16, released 2001-08-17
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-17, with a file datestamp of 2001-08-17.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1jlna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlnA (A:)
    gsprekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtkn
    ryktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqm
    vwqedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgs
    htqhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfi
    atsigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv