PDB entry 1jlm

View 1jlm on RCSB PDB site
Description: I-domain from integrin cr3, mn2+ bound
Class: cell adhesion protein
Keywords: integrin, cell adhesion protein, glycoprotein
Deposited on 1996-04-09, released 1997-01-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jlma_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jlmA (A:)
    gcpqedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftf
    kefqnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekf
    gdplgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealk
    tiqnqlrekifa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jlmA (A:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifa