PDB entry 1jlj

View 1jlj on RCSB PDB site
Description: 1.6 Angstrom crystal structure of the human neuroreceptor anchoring and molybdenum cofactor biosynthesis protein gephyrin
Class: structural protein
Keywords: globular alpha/beta fold, STRUCTURAL PROTEIN
Deposited on 2001-07-16, released 2001-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.148
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gephyrin
    Species: Homo sapiens [TaxId:9606]
    Gene: GEPHYRIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jlja_
  • Chain 'B':
    Compound: gephyrin
    Species: Homo sapiens [TaxId:9606]
    Gene: GEPHYRIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jljb_
  • Chain 'C':
    Compound: gephyrin
    Species: Homo sapiens [TaxId:9606]
    Gene: GEPHYRIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jljc_
  • Heterogens: NA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jljA (A:)
    mategmiltnhdhqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivp
    deieeiketlidwcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgsl
    nvtplgmlsrpvcgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevh
    drshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jljA (A:)
    hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
    wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
    cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jljB (B:)
    mategmiltnhdhqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivp
    deieeiketlidwcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgsl
    nvtplgmlsrpvcgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevh
    drshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jljB (B:)
    hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
    wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
    cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jljC (C:)
    mategmiltnhdhqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivp
    deieeiketlidwcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgsl
    nvtplgmlsrpvcgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevh
    drshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jljC (C:)
    hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
    wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
    cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd