PDB entry 1jl9

View 1jl9 on RCSB PDB site
Description: Crystal Structure of Human Epidermal Growth Factor
Deposited on 2001-07-16, released 2001-10-24
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-24, with a file datestamp of 2001-10-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jl9a_
  • Chain 'B':
    Domains in SCOP 1.59: d1jl9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jl9A (A:)
cplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jl9B (B:)
cplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkww