PDB entry 1jl7

View 1jl7 on RCSB PDB site
Description: Crystal Structure Of CN-Ligated Component III Glycera Dibranchiata Monomeric Hemoglobin
Deposited on 2001-07-16, released 2002-07-16
The last revision prior to the SCOP 1.71 freeze date was dated 2002-07-16, with a file datestamp of 2002-07-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.175
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jl7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jl7A (A:)
    glsaaqrqvvastwkdiagadngagvgkeclskfisahpemaavfgfsgasdpgvaelga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaaygdisgalisglqs