PDB entry 1jkz

View 1jkz on RCSB PDB site
Description: NMR Solution Structure of Pisum sativum defensin 1 (Psd1)
Class: antifungal protein
Keywords: nmr, plant defensin, cys-rich, antifungal, antifungal protein
Deposited on 2001-07-13, released 2002-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: defense-related peptide 1
  Species: Pisum sativum [TaxId:3888]
  Database cross-references and differences (RAF-indexed):
  • PDB 1JKZ (0-45)
  Domains in SCOPe 2.06: d1jkza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jkzA (A:)
  ktcehladtyrgvcftnascddhcknkahlisgtchnwkcfctqnc