PDB entry 1jkx

View 1jkx on RCSB PDB site
Description: Unexpected formation of an epoxide-derived multisubstrate adduct inhibitor on the active site of GAR transformylase
Class: transferase
Keywords: purine biosynthesis, anti-cancer agent, enzyme-assembled multisubstrate adduct inhibitor complex, transferase
Deposited on 2001-07-13, released 2001-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkxa_
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkxb_
  • Chain 'C':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkxc_
  • Chain 'D':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkxd_
  • Heterogens: 138, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jkxA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkxA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jkxB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkxB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jkxC (C:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkxC (C:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jkxD (D:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkxD (D:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgya