PDB entry 1jkw

View 1jkw on RCSB PDB site
Description: structure of cyclin mcs2
Class: cell division
Keywords: cyclin, cell cycle, cell division, nuclear protein
Deposited on 1996-10-11, released 1997-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin h
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN CYCLIN H
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51946
      • conflict (277)
    Domains in SCOPe 2.06: d1jkwa1, d1jkwa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jkwA (A:)
    myhnssqkrhwtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyy
    ekrllefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnv
    sspqfvgnlresplgqekaleqileyellliqqlnfhlivhnpyrpfegflidlktrypi
    lenpeilrktaddflnrialtdayllytpsqialtailssasragitmesylseslmlke
    nrtclsqlldimksmrnlvkkyepprseevavlkqkldrchsaelalnvitkkrkgyedd
    dyvskkskheeeewtdddlvesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkwA (A:)
    wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv
    fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr
    esplgqekaleqileyellliqqlnfhlivhnpyrpfegflidlktrypilenpeilrkt
    addflnrialtdayllytpsqialtailssasragitmesylseslmlkenrtclsqlld
    imksmrnlvkkyepprseevavlkqkldrchsaelal