PDB entry 1jkv

View 1jkv on RCSB PDB site
Description: Crystal Structure of Manganese Catalase from Lactobacillus plantarum complexed with azide
Class: oxidoreductase
Keywords: hexamer, catalase dimanganese, metalloenzyme, OXIDOREDUCTASE
Deposited on 2001-07-13, released 2002-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudocatalase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkva_
  • Chain 'B':
    Compound: pseudocatalase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkvb_
  • Chain 'C':
    Compound: pseudocatalase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkvc_
  • Chain 'D':
    Compound: pseudocatalase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkvd_
  • Chain 'E':
    Compound: pseudocatalase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkve_
  • Chain 'F':
    Compound: pseudocatalase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jkvf_
  • Heterogens: CA, OH, AZI, MN3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkvA (A:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkvB (B:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkvC (C:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkvD (D:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkvE (E:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkvF (F:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg